Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200827_WB10.jpg WB (Western Blot) (WB Suggested Anti-SPTAN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateSPTAN1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit SPTAN1 Polyclonal Antibody | anti-SPTAN1 antibody

SPTAN1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SPTAN1; NEAS; EIEE5; SPTA2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SPTAN1, Antibody; SPTAN1 antibody - N-terminal region; anti-SPTAN1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Sequence Length
2472
Applicable Applications for anti-SPTAN1 antibody
WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SPTAN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateSPTAN1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA200827_WB10.jpg WB (Western Blot) (WB Suggested Anti-SPTAN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateSPTAN1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

IP (Immunoprecipitation)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :SPTAN1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :SPTAN1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA200827_IP11.jpg IP (Immunoprecipitation) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :SPTAN1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :SPTAN1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohiostchemistry)

(Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue)

product-image-AAA200827_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-SPTAN1 antibody)

product-image-AAA200827_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Kidney tissue at an antibody concentration of 5ug/ml using anti-SPTAN1 antibody)
Related Product Information for anti-SPTAN1 antibody
This is a rabbit polyclonal antibody against SPTAN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Product Categories/Family for anti-SPTAN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
272kDa
NCBI Official Full Name
spectrin alpha chain, non-erythrocytic 1 isoform 2
NCBI Official Synonym Full Names
spectrin alpha, non-erythrocytic 1
NCBI Official Symbol
SPTAN1
NCBI Official Synonym Symbols
NEAS; EIEE5; SPTA2
NCBI Protein Information
spectrin alpha chain, non-erythrocytic 1
UniProt Protein Name
Spectrin alpha chain, non-erythrocytic 1
UniProt Gene Name
SPTAN1
UniProt Synonym Gene Names
NEAS; SPTA2
UniProt Entry Name
SPTN1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SPTAN1 sptan1 (Catalog #AAA200827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPTAN1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SPTAN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SPTAN1 sptan1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPSGVKVLE TAEDIQERRQ QVLDRYHRFK ELSTLRRQKL EDSYRFQFFQ. It is sometimes possible for the material contained within the vial of "SPTAN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.