Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281234_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using SRD5A1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Rabbit SRD5A1 Polyclonal Antibody | anti-SRD5A1 antibody

SRD5A1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
SRD5A1; S5AR 1
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
SRD5A1, Antibody; SRD5A1 Polyclonal Antibody; S5AR1; anti-SRD5A1 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF
Sequence Length
259
Applicable Applications for anti-SRD5A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1).
Cross-Reactivity
Mouse, Rat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using SRD5A1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

product-image-AAA281234_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using SRD5A1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Product Categories/Family for anti-SRD5A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Observed MW: 29kDa
Calculated MW: 29kDa
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform 1
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 1
NCBI Official Symbol
SRD5A1
NCBI Official Synonym Symbols
S5AR 1
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Gene Name
SRD5A1
UniProt Synonym Gene Names
S5AR 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SRD5A1 srd5a1 (Catalog #AAA281234) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SRD5A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SRD5A1 srd5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LIYPFLMRGG KPMPLLACTM AIMFCTCNGY LQSRYLSHCA VYADDWVTDP RFLIGFGLWL TGMLINIHSD HILRNLRKPG DTGYKIPRGG LFEYVTAANY F. It is sometimes possible for the material contained within the vial of "SRD5A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.