<
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded Rat liver using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Rabbit SREBP1 Polyclonal Antibody | anti-SREBP1 antibody
SREBP1 Rabbit pAb
Gene Names
SREBF1; SREBP1; bHLHd1; SREBP-1c
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
SREBP1, Antibody; SREBP1 Rabbit pAb; SREBF1; SREBP-1c; SREBP1; SREBP1a; bHLHd1; anti-SREBP1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPG
Applicable Applications for anti-SREBP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SREBF1 (NP_001005291.1).
Cellular Location
COPII-coated vesicle membrane, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein, Multi-pass membrane protein, Nucleus
Positive Samples
A-549, MCF7, U-87MG, Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded Rat liver using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded Rat liver using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemisry)
(Immunohistochemistry of paraffin-embedded Mouse liver using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemisry)
(Immunohistochemistry of paraffin-embedded Mouse liver using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded Human liver cancer using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded Human liver cancer using SREBP1 antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using SREBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using SREBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-SREBP1 antibody
Background: This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Product Categories/Family for anti-SREBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
121,675 Da
NCBI Official Full Name
sterol regulatory element-binding protein 1 isoform a
NCBI Official Synonym Full Names
sterol regulatory element binding transcription factor 1
NCBI Official Symbol
SREBF1
NCBI Official Synonym Symbols
SREBP1; bHLHd1; SREBP-1c
NCBI Protein Information
sterol regulatory element-binding protein 1; SREBP-1; class D basic helix-loop-helix protein 1
UniProt Protein Name
Sterol regulatory element-binding protein 1
UniProt Gene Name
SREBF1
UniProt Synonym Gene Names
BHLHD1; SREBP1; SREBP-1; bHLHd1
UniProt Entry Name
SRBP1_HUMAN
Similar Products
Product Notes
The SREBP1 srebf1 (Catalog #AAA281579) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SREBP1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SREBP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SREBP1 srebf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDEPPFSEAA LEQALGEPCD LDAALLTDIE GEVGAGRGRA NGLDAPRAGA DRGAMDCTFE DMLQLINNQD SDFPGLFDPP YAGSGAGGTD PASPDTSSPG. It is sometimes possible for the material contained within the vial of "SREBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.