Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200017_WB8.jpg WB (Western Blot) (WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateSRPRB is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit SRPRB Polyclonal Antibody | anti-SRPRB antibody

SRPRB antibody - middle region

Gene Names
SRPRB; APMCF1
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SRPRB, Antibody; SRPRB antibody - middle region; anti-SRPRB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Sequence Length
271
Applicable Applications for anti-SRPRB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SRPRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateSRPRB is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA200017_WB8.jpg WB (Western Blot) (WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateSRPRB is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: SRPRBSample Type: JurkatAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA200017_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: SRPRBSample Type: JurkatAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: SRPRBSample Type: HelaAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA200017_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SRPRBSample Type: HelaAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: SRPRBSample Type: 721_BAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200017_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SRPRBSample Type: 721_BAntibody Dilution: 1.0ug/mlSRPRB is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Rabbit Anti-SRPRB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200017_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SRPRB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SRPRB antibody
This is a rabbit polyclonal antibody against SRPRB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Product Categories/Family for anti-SRPRB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
signal recognition particle receptor subunit beta
NCBI Official Synonym Full Names
SRP receptor subunit beta
NCBI Official Symbol
SRPRB
NCBI Official Synonym Symbols
APMCF1
NCBI Protein Information
signal recognition particle receptor subunit beta
UniProt Protein Name
Signal recognition particle receptor subunit beta
UniProt Gene Name
SRPRB
UniProt Synonym Gene Names
SR-beta
UniProt Entry Name
SRPRB_HUMAN

Similar Products

Product Notes

The SRPRB srprb (Catalog #AAA200017) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRPRB antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SRPRB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SRPRB srprb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDIAMAKSAK LIQQQLEKEL NTLRVTRSAA PSTLYSSSTA PAQLGKKGKE. It is sometimes possible for the material contained within the vial of "SRPRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.