WB (Western Blot)
(WB Suggested Anti-SSX2IP Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysate)
Rabbit SSX2IP Polyclonal Antibody | anti-SSX2IP antibody
SSX2IP antibody - middle region
Gene Names
SSX2IP; ADIP; hMsd1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SSX2IP, Antibody; SSX2IP antibody - middle region; anti-SSX2IP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
Sequence Length
614
Applicable Applications for anti-SSX2IP antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SSX2IP Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysate)
WB (Western Blot)
(WB Suggested Anti-SSX2IP Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysate)
IHC (Immunohiostchemistry)
(Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSX2IP antibody)
IHC (Immunohiostchemistry)
(Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSX2IP antibody)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-SSX2IP antibody
This is a rabbit polyclonal antibody against SSX2IP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
Target Description: SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
Product Categories/Family for anti-SSX2IP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
afadin- and alpha-actinin-binding protein isoform 1
NCBI Official Synonym Full Names
SSX family member 2 interacting protein
NCBI Official Symbol
SSX2IP
NCBI Official Synonym Symbols
ADIP; hMsd1
NCBI Protein Information
afadin- and alpha-actinin-binding protein
UniProt Protein Name
Afadin- and alpha-actinin-binding protein
UniProt Gene Name
SSX2IP
UniProt Synonym Gene Names
KIAA0923; ADIP
UniProt Entry Name
ADIP_HUMAN
Similar Products
Product Notes
The SSX2IP ssx2ip (Catalog #AAA200323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSX2IP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SSX2IP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SSX2IP ssx2ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVHLEGFNDE DVISRQDHEQ ETEKLELEIQ QCKEMIKTQQ QLLQQQLATA. It is sometimes possible for the material contained within the vial of "SSX2IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.