Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281622_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using STAP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 240s.)

Rabbit anti-Human, Mouse STAP2 Polyclonal Antibody | anti-STAP2 antibody

STAP2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
STAP2; BKS
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
STAP2, Antibody; STAP2 Rabbit pAb; STAP2; BKS; anti-STAP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQP
Applicable Applications for anti-STAP2 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 130-220 of human STAP2 (NP_001013863).
Cellular Location
Cytoplasm
Positive Samples
Mouse heart, HT-29
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of HT-29 cells, using STAP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 240s.)

product-image-AAA281622_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using STAP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 240s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse heart, using STAP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281622_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse heart, using STAP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-STAP2 antibody
Background: This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,649 Da
NCBI Official Full Name
signal-transducing adaptor protein 2 isoform 2
NCBI Official Synonym Full Names
signal transducing adaptor family member 2
NCBI Official Symbol
STAP2
NCBI Official Synonym Symbols
BKS
NCBI Protein Information
signal-transducing adaptor protein 2; BRK substrate; breast tumor kinase substrate; brk kinase substrate; signal-transducing adaptor protein-2
UniProt Protein Name
Signal-transducing adaptor protein 2
UniProt Gene Name
STAP2
UniProt Synonym Gene Names
BKS; STAP-2; BRK substrate
UniProt Entry Name
STAP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STAP2 stap2 (Catalog #AAA281622) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAP2 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STAP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STAP2 stap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GHLYMMSEVL AKEEARRALE TPSCFLKVSR LEAQLLLERY PECGNLLLRP SGDGADGVSV TTRQMHNGTH VVRHYKVKRE GPKYVIDVEQ P. It is sometimes possible for the material contained within the vial of "STAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.