Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198410_WB11.jpg WB (Western Blot) (WB Suggested Anti-STAT1 Antibody Titration: 0.0625ug/mlPositive Control: Recombinant STAT1 protein)

Rabbit STAT1 Polyclonal Antibody | anti-STAT1 antibody

STAT1 antibody - C-terminal region

Gene Names
STAT1; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
STAT1, Antibody; STAT1 antibody - C-terminal region; anti-STAT1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEF
Sequence Length
750
Applicable Applications for anti-STAT1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 82%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAT1 Antibody Titration: 0.0625ug/mlPositive Control: Recombinant STAT1 protein)

product-image-AAA198410_WB11.jpg WB (Western Blot) (WB Suggested Anti-STAT1 Antibody Titration: 0.0625ug/mlPositive Control: Recombinant STAT1 protein)

WB (Western Blot)

(Host: MouseTarget Name: STAT1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA198410_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: STAT1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-STAT1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198410_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-STAT1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-STAT1 antibody
This is a rabbit polyclonal antibody against STAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STAT1 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.Western blots using four different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
signal transducer and activator of transcription 1-alpha/beta isoform alpha
NCBI Official Synonym Full Names
signal transducer and activator of transcription 1
NCBI Official Symbol
STAT1
NCBI Official Synonym Symbols
CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
NCBI Protein Information
signal transducer and activator of transcription 1-alpha/beta
UniProt Protein Name
Signal transducer and activator of transcription 1-alpha/beta
UniProt Gene Name
STAT1
UniProt Entry Name
STAT1_HUMAN

Similar Products

Product Notes

The STAT1 stat1 (Catalog #AAA198410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's STAT1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STAT1 stat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGPKGTGYIK TELISVSEVH PSRLQTTDNL LPMSPEEFDE VSRIVGSVEF. It is sometimes possible for the material contained within the vial of "STAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.