<
Application Data
(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.)
Rabbit STAT3 Polyclonal Antibody | anti-STAT3 antibody
STAT3 antibody - N-terminal region
Gene Names
STAT3; APRF; HIES; ADMIO; ADMIO1
Reactivity
Tested: Human,MousePredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
STAT3, Antibody; STAT3 antibody - N-terminal region; anti-STAT3 antibody
Host
Rabbit
Reactivity
Tested: Human,Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Sequence Length
769
Applicable Applications for anti-STAT3 antibody
IF (Immunofluorescence), WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (#AA)
769 amino acids
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Application Data
(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.)
Application Data
(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.)
Application Data
Application Data
WB (Western Blot)
(WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
WB (Western Blot)
(WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Uterus lysate tissue)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Uterus lysate tissue)
IHC (Immunohistochemisry)
(Immunohistochemistry with human prostate tissue tissue)
IHC (Immunohistochemisry)
(Immunohistochemistry with human prostate tissue tissue)
IHC (Immunohiostchemistry)
(Immunohistochemistry with Human kidney lysate tissue)
IHC (Immunohiostchemistry)
(Immunohistochemistry with Human kidney lysate tissue)
IHC (Immunohistochemistry)
(Immunofluorescence --Sample Type: MacrophagesDilution: 1:1000)
IHC (Immunohistochemistry)
(Immunofluorescence --Sample Type: MacrophagesDilution: 1:1000)
Related Product Information for anti-STAT3 antibody
This is a rabbit polyclonal antibody against STAT3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Target Description: STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-STAT3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
88kDa
NCBI Official Full Name
signal transducer and activator of transcription 3 isoform 2
NCBI Official Synonym Full Names
signal transducer and activator of transcription 3
NCBI Official Symbol
STAT3
NCBI Official Synonym Symbols
APRF; HIES; ADMIO; ADMIO1
NCBI Protein Information
signal transducer and activator of transcription 3
Similar Products
Product Notes
The STAT3 (Catalog #AAA198272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT3 antibody - N-terminal region reacts with Tested: Human,Mouse Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STAT3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the STAT3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQWNQLQQLD TRYLEQLHQL YSDSFPMELR QFLAPWIESQ DWAYAASKES. It is sometimes possible for the material contained within the vial of "STAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.