WB (Western Blot)
(WB Suggested Anti-Stmn1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Rabbit anti-Mouse Stmn1 Polyclonal Antibody | anti-STMN1 antibody
Stmn1 antibody - N-terminal region
Gene Names
Stmn1; 19k; Lag; P18; P19; Pig; Smn; Op18; Pp17; Pp18; Pp19; Pr22; Lap18
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Stmn1, Antibody; Stmn1 antibody - N-terminal region; L; S; p; La; PP; PR; op; p1; 19k; Lag; P18; P19; Pig; Smn; Op18; Pp17; Pp18; Pp19; Pr22; Lap18; metab; anti-STMN1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEI
Sequence Length
149aa
Applicable Applications for anti-STMN1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Protein Interactions
Kcnma1; Cdkn1b
Blocking Peptide
For anti-Stmn1 (MBS3214006) antibody is Catalog # MBS3238944.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Stmn1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
WB (Western Blot)
(WB Suggested Anti-Stmn1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-STMN1 antibody
This is a rabbit polyclonal antibody against Stmn1. It was validated on Western Blot
Target Description: Stmn1 is involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Stmn1 prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Stmn1 is involved in the control of the learned and innate fear.
Target Description: Stmn1 is involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Stmn1 prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Stmn1 is involved in the control of the learned and innate fear.
Product Categories/Family for anti-STMN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
stathmin
NCBI Official Synonym Full Names
stathmin 1
NCBI Official Symbol
Stmn1
NCBI Official Synonym Symbols
19k; Lag; P18; P19; Pig; Smn; Op18; Pp17; Pp18; Pp19; Pr22; Lap18
NCBI Protein Information
stathmin
UniProt Protein Name
Stathmin
UniProt Gene Name
Stmn1
UniProt Synonym Gene Names
Lag; Lap18; Pr22; Op18; pp19
UniProt Entry Name
STMN1_MOUSE
Similar Products
Product Notes
The STMN1 stmn1 (Catalog #AAA200842) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Stmn1 antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Stmn1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the STMN1 stmn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPDFPLSPP KKKDLSLEEI. It is sometimes possible for the material contained within the vial of "Stmn1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.