Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19271_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

Rabbit Synaptopodin/SYNPO Polyclonal Antibody | anti-SYNPO antibody

Anti-Synaptopodin/SYNPO Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Synaptopodin/SYNPO, Antibody; Anti-Synaptopodin/SYNPO Antibody; SYNPO; KIAA1029; Synaptopodin; synaptopodin; anti-SYNPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for Synaptopodin/SYNPO detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Applicable Applications for anti-SYNPO antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
Application Notes
WB: 0.1-0.25ug/ml|Human, Mouse, Rat|
IHC-P: 2-5ug/ml|Human, Mouse, Rat|
ICC/IF: 5ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Human|
Immunogen
A synthetic peptide corresponding to a sequence of human Synaptopodin/SYNPO (EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19271_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

FCM (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of U87 cells using anti- Synaptopodin/SYNPO antibody (AAA19271).Overlay histogram showing U87 cells stained with AAA19271 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti- Synaptopodin/SYNPO Antibody (AAA19271, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19271_FCM5.png FCM (Flow Cytometry) (Figure 5. Flow Cytometry analysis of U87 cells using anti- Synaptopodin/SYNPO antibody (AAA19271).Overlay histogram showing U87 cells stained with AAA19271 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti- Synaptopodin/SYNPO Antibody (AAA19271, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 4. IF analysis of Synaptopodin/SYNPO using anti- Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19271_IF4.jpg IF (Immunofluorescence) (Figure 4. IF analysis of Synaptopodin/SYNPO using anti- Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of human renal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19271_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of human renal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19271_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Synaptopodin/SYNPO using anti-Synaptopodin/SYNPO antibody (AAA19271).Synaptopodin/SYNPO was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Synaptopodin/SYNPO Antibody (AAA19271) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Synaptopodin/SYNPO using anti- Synaptopodin/SYNPO antibody (AAA19271).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysatesLane 3: human SH-SY5Y whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-Synaptopodin/SYNPO antigen affinity purified polyclonal antibody (Catalog # AAA19271) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Synaptopodin/SYNPO at approximately 99KD. The expected band size for Synaptopodin/SYNPO is at 99KD.)

product-image-AAA19271_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of Synaptopodin/SYNPO using anti- Synaptopodin/SYNPO antibody (AAA19271).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysatesLane 3: human SH-SY5Y whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-Synaptopodin/SYNPO antigen affinity purified polyclonal antibody (Catalog # AAA19271) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Synaptopodin/SYNPO at approximately 99KD. The expected band size for Synaptopodin/SYNPO is at 99KD.)
Related Product Information for anti-SYNPO antibody
The spine apparatus(SA) is a specialized form of endoplasmic reticulum(ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin(which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.
References
1. Cooney; Hurlburt, JL; Selig, DK; Harris, KM; Fiala, JC (2002). "Endosomal compartments serve multiple hippocampal dendritic spines from a widespread rather than a local store of recycling membrane". The Journal of neuroscience : the official journal of the Society for Neuroscience 22 (6): 2215-24.
2. Deller; Merten, T; Roth, SU; Mundel, P; Frotscher, M (2000). "Actin-associated protein synaptopodin in the rat hippocampal formation: localization in the spine neck and close association with the spine apparatus of principal neurons". The Journal of Comparative Neurology 418 (2): 164-81
3. Gray (1959). "Electron microscopy of synaptic contacts on dendrite spines of the cerebral cortex". Nature 183 (4675): 1592-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99,463 Da
NCBI Official Full Name
synaptopodin isoform B
NCBI Official Synonym Full Names
synaptopodin
NCBI Official Symbol
SYNPO
NCBI Protein Information
synaptopodin
UniProt Protein Name
Synaptopodin
UniProt Gene Name
SYNPO
UniProt Synonym Gene Names
KIAA1029
UniProt Entry Name
SYNPO_HUMAN

Similar Products

Product Notes

The SYNPO synpo (Catalog #AAA19271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Synaptopodin/SYNPO Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Synaptopodin/SYNPO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM). WB: 0.1-0.25ug/ml|Human, Mouse, Rat| IHC-P: 2-5ug/ml|Human, Mouse, Rat| ICC/IF: 5ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Human|. Researchers should empirically determine the suitability of the SYNPO synpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Synaptopodin/SYNPO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.