Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200934_WB10.jpg WB (Western Blot) (Syt1 antibody - middle region validated by WB using Mouse Spleen lysate at 1.0ug/ml.)

Rabbit Syt1 Polyclonal Antibody | anti-SYT1 antibody

Syt1 antibody - middle region

Gene Names
Syt1; SytI; AW124717; G630098F17Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Syt1, Antibody; Syt1 antibody - middle region; anti-SYT1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL
Sequence Length
421
Applicable Applications for anti-SYT1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Syt1 antibody - middle region validated by WB using Mouse Spleen lysate at 1.0ug/ml.)

product-image-AAA200934_WB10.jpg WB (Western Blot) (Syt1 antibody - middle region validated by WB using Mouse Spleen lysate at 1.0ug/ml.)

WB (Western Blot)

(Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Syt1Submitted by:Anonymous)

product-image-AAA200934_WB11.jpg WB (Western Blot) (Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Syt1Submitted by:Anonymous)

IHC (Immunohiostchemistry)

(Sample Type: Mouse outer plexiformSample Type:outer mouse plexiform layerRed:PrimaryBlue:DAPIPrimary Dilution:1:200Secondary Antibody:Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution:1:200Image Submitted by:David ZenisekYale University)

product-image-AAA200934_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Mouse outer plexiformSample Type:outer mouse plexiform layerRed:PrimaryBlue:DAPIPrimary Dilution:1:200Secondary Antibody:Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution:1:200Image Submitted by:David ZenisekYale University)

IHC (Immunohistochemistry)

(Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University)

product-image-AAA200934_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimary Dilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)Secondary Dilution: 1:200Image Submitted by: David ZenisekYale University)
Related Product Information for anti-SYT1 antibody
This is a rabbit polyclonal antibody against Syt1. It was validated on Western Blot

Target Description: Syt1 may have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca2+-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca2+-independent manner; these are neurexins, syntaxin and AP2.
Product Categories/Family for anti-SYT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
synaptotagmin-1 isoform 1
NCBI Official Synonym Full Names
synaptotagmin I
NCBI Official Symbol
Syt1
NCBI Official Synonym Symbols
SytI; AW124717; G630098F17Rik
NCBI Protein Information
synaptotagmin-1
UniProt Protein Name
Synaptotagmin-1
UniProt Gene Name
Syt1
UniProt Synonym Gene Names
SytI

Similar Products

Product Notes

The SYT1 syt1 (Catalog #AAA200934) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Syt1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Syt1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SYT1 syt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDRFSKHDII GEFKVPMNTV DFGHVTEEWR DLQSAEKEEQ EKLGDICFSL. It is sometimes possible for the material contained within the vial of "Syt1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.