<
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
Rabbit anti-Human TAGLN Polyclonal Antibody | anti-TAGLN antibody
TAGLN Rabbit pAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TAGLN, Antibody; TAGLN Rabbit pAb; SM22; SMCC; TAGLN1; WS3-10; SM22-alpha; anti-TAGLN antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
AAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Applicable Applications for anti-TAGLN antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-201 of human TAGLN (NP_003177.2-).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast tissue using TAGLN Rabbit pAb (AAA283306) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from Hep G2 cells using TAGLN Rabbit pAb (AAA283306) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time:10s.)
WB (Western Blot)
(Western blot analysis of lysates from Hep G2 cells using TAGLN Rabbit pAb (AAA283306) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time:10s.)
Related Product Information for anti-TAGLN antibody
This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.
Product Categories/Family for anti-TAGLN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 23kDa
Observed MW: 23kDa
Observed MW: 23kDa
UniProt Protein Name
Transgelin
UniProt Gene Name
TAGLN
UniProt Synonym Gene Names
SM22; WS3-10; SM22-alpha
UniProt Entry Name
TAGL_HUMAN
Similar Products
Product Notes
The TAGLN tagln (Catalog #AAA283306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAGLN Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAGLN can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TAGLN tagln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AAEDYGVIKT DMFQTVDLFE GKDMAAVQRT LMALGSLAVT KNDGHYRGDP NWFMKKAQEH KREFTESQLQ EGKHVIGLQM GSNRGASQAG MTGYGRPRQI IS. It is sometimes possible for the material contained within the vial of "TAGLN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.