Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46326_IHC13.jpg IHC (Immunohiostchemistry) (Anti- TAP1 Picoband antibody, AAA46326, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

anti-Human TAP1 Polyclonal Antibody | anti-TAP1 antibody

Anti-TAP1 Antibody

Gene Names
TAP1; APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TAP1, Antibody; Anti-TAP1 Antibody; Antigen peptide transporter 1; ABC 17; ABC transporter MHC 1; ABC17; ABCB 2; ABCB2; APT 1; APT1; ATP binding cassette sub family B (MDR/TAP) member 2; ATP binding cassette sub family B member 2; ATP binding cassette transporter; ATP-binding cassette sub-family B member 2; D6S114E; FLJ26666; FLJ41500; Peptide supply factor 1; Peptide transporter involved in antigen processing 1; Peptide transporter PSF 1; Peptide transporter PSF1; Peptide transporter TAP 1; Peptide transporter TAP1; PSF 1; PSF-1; PSF1; Really interesting new gene 4 protein; RING 4; RING4; TAP 1; TAP1; TAP1*0102N; TAP1_HUMAN; TAP1N; Transporter 1 ATP binding cassette sub family B (MDR/TAP); Transporter 1 ATP binding cassette sub family B; Transporter associated with antigen processing; Transporter ATP binding cassette major histocompatibility complex 1; Y3; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); anti-TAP1 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
808
Applicable Applications for anti-TAP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- TAP1 Picoband antibody, AAA46326, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46326_IHC13.jpg IHC (Immunohiostchemistry) (Anti- TAP1 Picoband antibody, AAA46326, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

WB (Western Blot)

(Anti- TAP1 Picoband antibody, AAA46326, Western blottingAll lanes: Anti TAP1 (AAA46326) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: HUT Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD)

product-image-AAA46326_WB15.jpg WB (Western Blot) (Anti- TAP1 Picoband antibody, AAA46326, Western blottingAll lanes: Anti TAP1 (AAA46326) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: HUT Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugPredicted bind size: 87KDObserved bind size: 87KD)
Related Product Information for anti-TAP1 antibody
Description: Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.

Background: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: TAP1 transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)". 2. Bahram S, Arnold D, Bresnahan M, Strominger JL, Spies T (Dec 1991). "Two putative subunits of a peptide pump encoded in the human major histocompatibility complex class II region". Proc Natl Acad Sci U S A 88 (22): 10094-8. 3. Bodmer JG, Marsh SG, Albert ED, Bodmer WF, Dupont B, Erlich HA, Mach B, Mayr WR, Parham P, Sasazuki T (Oct 1992). "Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Committee for factors of the HLA system". Tissue Antigens 39 (4): 161-73.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,218 Da
NCBI Official Full Name
antigen peptide transporter 1 isoform 1
NCBI Official Synonym Full Names
transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
NCBI Official Symbol
TAP1
NCBI Official Synonym Symbols
APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
NCBI Protein Information
antigen peptide transporter 1
UniProt Protein Name
Antigen peptide transporter 1
UniProt Gene Name
TAP1
UniProt Synonym Gene Names
ABCB2; PSF1; RING4; Y3; APT1; PSF-1
UniProt Entry Name
TAP1_HUMAN

Similar Products

Product Notes

The TAP1 tap1 (Catalog #AAA46326) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TAP1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TAP1 tap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.