<
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.)
Rabbit TAP1 Polyclonal Antibody | anti-TAP1 antibody
TAP1 antibody - middle region
Gene Names
TAP1; APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TAP1, Antibody; TAP1 antibody - middle region; anti-TAP1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
Sequence Length
808
Applicable Applications for anti-TAP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAP1
Protein Size (# AA)
808 amino acids
Predicted Homology based on Immunogen Sequence
Cow: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 83%
Protein Interactions
UBC; MUL1; TDP2; SFXN1; GADD45GIP1; MRPL40; MCAT; SRSF3; SDHA; ABCD3; CYC1; PSMB8; TAPBP; TAP2; HLA-A; PDIA3; CALR; B2M; PDIA2; KRTAP4-12; MDFI; PSMB5; HLA-F; HLA-G; ESR1; COPG1; COPB1;
Enhanced Validation
Relative Expression (Western Blot)
Sample Type Confirmation
TAP1 is supported by BioGPS gene expression data to be expressed in HeLa
Blocking Peptide
For anti-TAP1 (MBS3206966) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.)
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.)
WB (Western Blot)
(Host: RabbiTarget: TAP1Positive control (+): Human Ovary (OV) Negative control (-): HepG2 (HG)Antibody concentration: 4ug/ml.)
WB (Western Blot)
(Host: RabbiTarget: TAP1Positive control (+): Human Ovary (OV) Negative control (-): HepG2 (HG)Antibody concentration: 4ug/ml.)
WB (Western Blot)
(WB Suggested Anti-TAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-TAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: TAP1Sample Type: HelaAntibody Dilution: 1.0ug/mlTAP1 is supported by BioGPS gene expression data to be expressed in HeLa)
WB (Western Blot)
(Host: RabbitTarget Name: TAP1Sample Type: HelaAntibody Dilution: 1.0ug/mlTAP1 is supported by BioGPS gene expression data to be expressed in HeLa)
IHC (Immunohistochemistry)
(Rabbit Anti-TAP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-TAP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TAP1 antibody
This is a rabbit polyclonal antibody against TAP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
antigen peptide transporter 1 isoform 1
NCBI Official Synonym Full Names
transporter 1, ATP binding cassette subfamily B member
NCBI Official Symbol
TAP1
NCBI Official Synonym Symbols
APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
NCBI Protein Information
antigen peptide transporter 1
UniProt Protein Name
Antigen peptide transporter 1
UniProt Gene Name
TAP1
UniProt Synonym Gene Names
ABCB2; PSF1; RING4; Y3; APT1; PSF-1
UniProt Entry Name
TAP1_HUMAN
Similar Products
Product Notes
The TAP1 tap1 (Catalog #AAA199290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAP1 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TAP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAP1 tap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVTFVLYQMQ FTQAVEVLLS IYPRVQKAVG SSEKIFEYLD RTPRCPPSGL. It is sometimes possible for the material contained within the vial of "TAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.