Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23421_SDS_PAGE6.jpg SDS-PAGE (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.)

Rabbit TBX20 Polyclonal Antibody | anti-TBX20 antibody

TBX20 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TBX20; ASD4
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TBX20, Antibody; TBX20 antibody - N-terminal region; anti-TBX20 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS
Sequence Length
447
Applicable Applications for anti-TBX20 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX20
Protein Interactions
UBC; ZSCAN1
Blocking Peptide
For anti-TBX20 (AAA23421) antibody is Catalog # ( )
Protein Size (# AA)
447 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

SDS-PAGE

(25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.)

product-image-AAA23421_SDS_PAGE6.jpg SDS-PAGE (25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.)

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown)

product-image-AAA23421_APP5.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown)

WB (Western Blot)

(Host: RabbitTarget Name: TBX20Sample Type: Jurkat cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA23421_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: TBX20Sample Type: Jurkat cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: TBX20Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA23421_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: TBX20Sample Tissue: Human HepG2Antibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody (AAA23421))

product-image-AAA23421_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody (AAA23421))

IHC (Immunohistochemistry)

(Human Muscle)

product-image-AAA23421_IHC.jpg IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-TBX20 antibody
This is a rabbit polyclonal antibody against TBX20. It was validated on Western Blot and immunohistochemistry

Target Description: TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
T-box transcription factor TBX20 isoform 2
NCBI Official Synonym Full Names
T-box 20
NCBI Official Symbol
TBX20
NCBI Official Synonym Symbols
ASD4
NCBI Protein Information
T-box transcription factor TBX20
UniProt Protein Name
T-box transcription factor TBX20
UniProt Gene Name
TBX20
UniProt Synonym Gene Names
T-box protein 20
UniProt Entry Name
TBX20_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TBX20 tbx20 (Catalog #AAA23421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX20 antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TBX20 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TBX20 tbx20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEFTASPKPQ LSSRANAFSI AALMSSGGSK EKEATENTIK PLEQFVEKSS. It is sometimes possible for the material contained within the vial of "TBX20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.