IP (Immunoprecipitation)
(Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug TCEB2 antibody. Western blot was performed from the immunoprecipitate using TCEB2 antibody at a dilition of 1:500.)
Rabbit anti-Human TCEB2 Polyclonal Antibody | anti-TCEB2 antibody
TCEB2 Polyclonal Antibody
Gene Names
ELOB; SIII; TCEB2
Reactivity
Human
Applications
Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
TCEB2, Antibody; TCEB2 Polyclonal Antibody; SIII; TCEB2; anti-TCEB2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Sequence Length
118
Applicable Applications for anti-TCEB2 antibody
IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human TCEB2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug TCEB2 antibody. Western blot was performed from the immunoprecipitate using TCEB2 antibody at a dilition of 1:500.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug TCEB2 antibody. Western blot was performed from the immunoprecipitate using TCEB2 antibody at a dilition of 1:500.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using TCEB2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using TCEB2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-TCEB2 antibody
This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.
Product Categories/Family for anti-TCEB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 13kDa; 17kDa
Observed: 16kDa
Observed: 16kDa
NCBI Official Full Name
elongin-B isoform a
NCBI Official Synonym Full Names
elongin B
NCBI Official Symbol
ELOB
NCBI Official Synonym Symbols
SIII; TCEB2
NCBI Protein Information
elongin-B
UniProt Protein Name
Elongin-B
UniProt Gene Name
ELOB
UniProt Synonym Gene Names
EloB
Similar Products
Product Notes
The TCEB2 elob (Catalog #AAA281034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCEB2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCEB2 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TCEB2 elob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVFLMIRRH KTTIFTDAKE SSTVFELKRI VEGILKRPPD EQRLYKDDQL LDDGKTLGEC GFTSQTARPQ APATVGLAFR ADDTFEALCI EPFSSPPELP DVMKPQDSGS SANEQAVQ. It is sometimes possible for the material contained within the vial of "TCEB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.