WB (Western Blot)
(WB Suggested Anti-TDGF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit anti-Human TDGF1 Polyclonal Antibody | anti-TDGF1 antibody
TDGF1 antibody - middle region
Gene Names
TDGF1; CR; CR-1; CRGF; CRIPTO
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TDGF1, Antibody; TDGF1 antibody - middle region; anti-TDGF1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSY
Sequence Length
188
Applicable Applications for anti-TDGF1 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TDGF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TDGF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-TDGF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: TDGF1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: TDGF1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TDGF1 antibody
This is a rabbit polyclonal antibody against TDGF1. It was validated on Western Blot
Target Description: This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Target Description: This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-TDGF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
teratocarcinoma-derived growth factor 1 isoform 1
NCBI Official Synonym Full Names
teratocarcinoma-derived growth factor 1
NCBI Official Symbol
TDGF1
NCBI Official Synonym Symbols
CR; CR-1; CRGF; CRIPTO
NCBI Protein Information
teratocarcinoma-derived growth factor 1
UniProt Protein Name
Teratocarcinoma-derived growth factor 1
UniProt Gene Name
TDGF1
UniProt Synonym Gene Names
CRIPTO; CRGF
UniProt Entry Name
TDGF1_HUMAN
Similar Products
Product Notes
The TDGF1 tdgf1 (Catalog #AAA199554) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TDGF1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TDGF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TDGF1 tdgf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRCFPQAFLP GCDGLVMDEH LVASRTPELP PSARTTTFML VGICLSIQSY. It is sometimes possible for the material contained within the vial of "TDGF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.