Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282262_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-87MG cells using Tenascin C Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Tenascin C Polyclonal Antibody | anti-RHOC antibody

Tenascin C Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
RHOC; H9; ARH9; ARHC; RHOH9
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Tenascin C, Antibody; Tenascin C Rabbit pAb; 150-225; DFNA56; GMEM; GP; HXB; JI; TN; TN-C; TNC; anti-RHOC antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
NIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Applicable Applications for anti-RHOC antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
U-138MG
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1990-2201 of human Tenascin C (NP_002151.2).
Cellular Location
basement membrane, endoplasmic reticulum lumen, extracellular region, extracellular space, focal adhesion
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-87MG cells using Tenascin C Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282262_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-87MG cells using Tenascin C Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using Tenascin C antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282262_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using Tenascin C antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of U-138MG, using Tenascin C antibody at 1:1205 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA282262_WB15.jpg WB (Western Blot) (Western blot analysis of U-138MG, using Tenascin C antibody at 1:1205 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-RHOC antibody
This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. [provided by RefSeq, Jul 2011]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
389
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
193
NCBI Official Full Name
rho-related GTP-binding protein RhoC
NCBI Official Synonym Full Names
ras homolog family member C
NCBI Official Symbol
RHOC
NCBI Official Synonym Symbols
H9; ARH9; ARHC; RHOH9
NCBI Protein Information
rho-related GTP-binding protein RhoC; rhoC GTPase; oncogene RHO H9; rho cDNA clone 9; RAS-related homolog 9; small GTP binding protein RhoC; ras homolog gene family, member C
UniProt Protein Name
Rho-related GTP-binding protein RhoC
UniProt Gene Name
RHOC
UniProt Synonym Gene Names
ARH9; ARHC; h9
UniProt Entry Name
RHOC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RHOC rhoc (Catalog #AAA282262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tenascin C Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tenascin C can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RHOC rhoc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NIPEKWTPEV KHFCPNVPII LVGNKKDLRQ DEHTRRELAK MKQEPVRSEE GRDMANRISA FGYLECSAKT KEGVREVFEM ATRAGLQVRK NKRRRGCPIL. It is sometimes possible for the material contained within the vial of "Tenascin C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.