Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281102_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using TFAM antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse TFAM Polyclonal Antibody | anti-TFAM antibody

TFAM Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
TFAM; TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
TFAM, Antibody; TFAM Polyclonal Antibody; MTDPS15; MTTF1; MTTFA; TCF6; TCF6L1; TCF6L2; TCF6L3; anti-TFAM antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEE
Sequence Length
214
Applicable Applications for anti-TFAM antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human TFAM
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using TFAM antibody at dilution of 1:100 (40x lens).)

product-image-AAA281102_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using TFAM antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using TFAM antibody at dilution of 1:100 (40x lens).)

product-image-AAA281102_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using TFAM antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using TFAM antibody at dilution of 1:100 (40x lens).)

product-image-AAA281102_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human esophageal cancer using TFAM antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human prostate cancer using TFAM antibody at dilution of 1:100 (40x lens).)

product-image-AAA281102_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human prostate cancer using TFAM antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TFAM antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281102_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TFAM antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-TFAM antibody
This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TFAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 25kDa; 29kDa
Observed: 24kDa
NCBI Official Full Name
transcription factor A, mitochondrial isoform 2
NCBI Official Synonym Full Names
transcription factor A, mitochondrial
NCBI Official Symbol
TFAM
NCBI Official Synonym Symbols
TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15
NCBI Protein Information
transcription factor A, mitochondrial
UniProt Protein Name
Transcription factor A, mitochondrial
UniProt Gene Name
TFAM
UniProt Synonym Gene Names
TCF6; TCF6L2; mtTFA; MtTF1; TCF-6

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TFAM tfam (Catalog #AAA281102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFAM Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TFAM can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TFAM tfam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAFLRSMWGV LSALGRSGAE LCTGCGSRLR SPFSFVYLPR WFSSVLASCP KKPVSSYLRF SKEQLPIFKA QNPDAKTTEL IRRIAQRWRE LPDSKKKIYQ DAYRAEWQVY KEEISRFKEQ LTPSQIMSLE KEIMDKHLKR KAMTKKKELT LLGKPKRPRS AYNVYVAERF QEAKGDSPQE KLKTVKENWK NLSDSEKELY IQHAKEDETR YHNEMKSWEE. It is sometimes possible for the material contained within the vial of "TFAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.