Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46329_WB15.jpg WB (Western Blot) (Anti-TGFBR2 Picoband antibody, AAA46329, Western blottingAll lanes: Anti TGFBR2 (AAA46329) at 0.5ug/mlLane 1: MCF-7 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: 22RV1 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD)

anti-Human TGFBR2 Polyclonal Antibody | anti-TGFBR2 antibody

Anti-TGFBR2 Antibody

Average rating 0.0
No ratings yet
Gene Names
TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TGFBR2, Antibody; Anti-TGFBR2 Antibody; TGF-beta receptor type-2; AAT 3; AAT3; FAA 3; FAA3; HNPCC6; LDS1B; LDS2B; MFS 2; MFS2; RIIC; TAAD 2; TAAD2; TbetaR II; TbetaR-II; TGF beta receptor type 2; TGF beta receptor type II; TGF beta receptor type IIB; TGF beta type II receptor; TGF-beta receptor type II; TGF-beta type II receptor; TGFB R2; TGFbeta RII; TGFBR 2; TGFBR2; TGFR 2; TGFR-2; TGFR2; TGFR2_HUMAN; Transforming growth factor beta receptor II; Transforming growth factor beta receptor type II; Transforming growth factor beta receptor type IIC; Transforming growth factor-beta receptor type II antibody; transforming growth factor, beta receptor II (70/80kDa); anti-TGFBR2 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
No cross reactivity with other proteins
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
592
Applicable Applications for anti-TGFBR2 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
Reconstitution
0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time.
Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti-TGFBR2 Picoband antibody, AAA46329, Western blottingAll lanes: Anti TGFBR2 (AAA46329) at 0.5ug/mlLane 1: MCF-7 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: 22RV1 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD)

product-image-AAA46329_WB15.jpg WB (Western Blot) (Anti-TGFBR2 Picoband antibody, AAA46329, Western blottingAll lanes: Anti TGFBR2 (AAA46329) at 0.5ug/mlLane 1: MCF-7 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: 22RV1 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD)
Related Product Information for anti-TGFBR2 antibody
Background: TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II(TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
References
1. Hagen, G., Muller, S., Beato, M., Suske, G. Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes. Nucleic Acids Res. 20: 5519-5525, 1992. 2. Lin, H. Y., Wang, X.-F., Ng-Eaton, E., Weinberg, R. A., Lodish, H. F. Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase. Cell 68: 775-785, 1992. 3. Hahm, K.-B., Cho, K., Lee, C., Im, Y.-H., Chang, J., Choi, S.-G., Sorensen, P. H. B., Thiele, C. J., Kim, S.-J.Repression of the gene encoding the TGF-beta type II receptor is a major target of the EWS-FLI1 oncoprotein. Nature Genet. 23: 222-227, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
TGF-beta receptor type-2 isoform A
NCBI Official Synonym Full Names
transforming growth factor beta receptor 2
NCBI Official Symbol
TGFBR2
NCBI Official Synonym Symbols
AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
NCBI Protein Information
TGF-beta receptor type-2
UniProt Protein Name
TGF-beta receptor type-2
UniProt Gene Name
TGFBR2
UniProt Synonym Gene Names
TGFR-2; TGF-beta receptor type II; TbetaR-II
UniProt Entry Name
TGFR2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TGFBR2 tgfbr2 (Catalog #AAA46329) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TGFBR2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TGFBR2 tgfbr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TGFBR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.