Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46490_IHC11.jpg IHC (Immunohistochemisry) (Anti- TH Picoband antibody, AAA46490,IHC(P)IHC(P): Rat Brain Tissue)

TH Polyclonal Antibody | anti-TH antibody

Anti-TH Antibody

Average rating 0.0
No ratings yet
Gene Names
TH; TYH; DYT14; DYT5b
Reactivity
Mouse, Rat
Predicted to work with: Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TH, Antibody; Anti-TH Antibody; Tyrosine 3-monooxygenase; Dystonia 14; DYT14; DYT5b; EC 1.14.16.2; OTTHUMP00000011225; OTTHUMP00000011226; ple; Protein Pale; TH; The; TY3H_HUMAN; TYH; Tyrosine 3 hydroxylase; Tyrosine 3 monooxygenase; Tyrosine 3-hydroxylase; Tyrosine hydroxylase; tyrosine hydroxylase; anti-TH antibody
Ordering
Reactivity
Mouse, Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
497
Applicable Applications for anti-TH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- TH Picoband antibody, AAA46490,IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46490_IHC11.jpg IHC (Immunohistochemisry) (Anti- TH Picoband antibody, AAA46490,IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Tyrosine Hydroxylase Picoband antibody, AAA46490,IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46490_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Tyrosine Hydroxylase Picoband antibody, AAA46490,IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- Tyrosine Hydroxylase Picoband antibody, AAA46490, Western blottingAll lanes: Anti Tyrosine Hydroxylase (AAA46490) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 59KDObserved bind size: 59KD)

product-image-AAA46490_WB15.jpg WB (Western Blot) (Anti- Tyrosine Hydroxylase Picoband antibody, AAA46490, Western blottingAll lanes: Anti Tyrosine Hydroxylase (AAA46490) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 59KDObserved bind size: 59KD)
Related Product Information for anti-TH antibody
Description: Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse;Rat.

Background: TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).
References
1. Haavik J, Toska K (June 1998). "Tyrosine hydroxylase and Parkinson's disease". Mol. Neurobiol. 16 (3): 285-309. 2. Kaufman S (1995). "Tyrosine hydroxylase". Adv. Enzymol. Relat. Areas Mol. Biol. Advances in Enzymology - and Related Areas of Molecular Biology 70: 103-220. Nagatsu T (1995). "Tyrosine hydroxylase: human isoforms, structure and regulation in physiology and pathology". Essays Biochem.30: 15-35.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,898 Da
NCBI Official Full Name
tyrosine 3-monooxygenase isoform b
NCBI Official Synonym Full Names
tyrosine hydroxylase
NCBI Official Symbol
TH
NCBI Official Synonym Symbols
TYH; DYT14; DYT5b
NCBI Protein Information
tyrosine 3-monooxygenase
UniProt Protein Name
Tyrosine 3-monooxygenase
UniProt Gene Name
TH
UniProt Synonym Gene Names
TYH; TH
UniProt Entry Name
TY3H_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TH th (Catalog #AAA46490) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TH Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's TH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TH th for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.