Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198102_WB13.jpg WB (Western Blot) (WB Suggested Anti-TJP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit TJP1 Polyclonal Antibody | anti-TJP1 antibody

TJP1 antibody - middle region

Gene Names
TJP1; ZO-1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TJP1, Antibody; TJP1 antibody - middle region; anti-TJP1 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
Sequence Length
1668
Applicable Applications for anti-TJP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 87%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TJP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TJP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA198102_WB13.jpg WB (Western Blot) (WB Suggested Anti-TJP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Testis)

product-image-AAA198102_IHC15.jpg IHC (Immunohistochemistry) (Testis)
Related Product Information for anti-TJP1 antibody
This is a rabbit polyclonal antibody against TJP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell junctions.This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Two transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
187kDa
NCBI Official Full Name
tight junction protein ZO-1 isoform b
NCBI Official Synonym Full Names
tight junction protein 1
NCBI Official Symbol
TJP1
NCBI Official Synonym Symbols
ZO-1
NCBI Protein Information
tight junction protein ZO-1
UniProt Protein Name
Tight junction protein ZO-1
UniProt Gene Name
TJP1
UniProt Synonym Gene Names
ZO1
UniProt Entry Name
ZO1_HUMAN

Similar Products

Product Notes

The TJP1 tjp1 (Catalog #AAA198102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TJP1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TJP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TJP1 tjp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QNHVLKQPAV SHPGHRPDKE PNLTYEPQLP YVEKQASRDL EQPTYRYESS. It is sometimes possible for the material contained within the vial of "TJP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.