Rabbit anti-Human TLR3 Polyclonal Antibody | anti-TLR3 antibody

Human TLR3 Rabbit pAb

Cat. Num. AAA283256

• Reactivity: Human
• Applications: ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
• Purity: Affinity purification
• Synonyms: TLR3, Antibody; Human TLR3 Rabbit pAb; TLR3; CD283; IIAE2; toll-like receptor 3; Human TLR3; anti-TLR3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
• Sequence: STTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSIS

• Applicable Applications for anti-TLR3 antibody: ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
• Immunogen: Recombinant Protein corresponding to a sequence within amino acids 24-339 of human Human TLR3(NP_003256.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of Jurkat cells using Human TLR3 Rabbit pAb(AAA283256) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Raji cells using Human TLR3 Rabbit pAb(AAA283256) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TLR3 using Human TLR3 Rabbit pAb (AAA283256) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-TLR3 antibody

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta and pancreas, and is restricted to the dendritic subpopulation of the leukocytes. It recognizes dsRNA associated with viral infection, and induces the activation of NF-kappaB and the production of type I interferons. It may thus play a role in host defense against viruses. Use of alternative polyadenylation sites to generate different length transcripts has been noted for this gene.

Product Categories/Family for anti-TLR3 antibody

Signal Transduction; Immunology & Inflammation; CD markers; NF-kB Signaling Pathway; Toll-like Receptor Signaling Pathway; Cell Intrinsic Innate Immunity Signaling Pathway; Chemokines; TLR Signaling; Chemokine; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 86161330
• NCBI GeneID: 7098
• UniProt Accession #: O15455; Q4VAL2
• Molecular Weight: Calculated MW: 72kDa/103kDa; Observed MW: 130kDa
• UniProt Protein Name: Toll-like receptor 3
• UniProt Gene Name: TLR3
• UniProt Entry Name: TLR3_HUMAN