Rabbit Tmem106b Polyclonal Antibody | anti-TMEM106B antibody
Tmem106b antibody - C-terminal region
Gene Names
Tmem106b; AI428776; AI661344; 2310036D22Rik; 5830455K21Rik; 6430519M21Rik
Reactivity
Tested Species Reactivity: MousePredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tmem106b, Antibody; Tmem106b antibody - C-terminal region; anti-TMEM106B antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Mouse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDC
Sequence Length
275
Applicable Applications for anti-TMEM106B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Protein Size (# AA)
275 amino acids
Blocking Peptide
For anti-Tmem106b (MBS3208574) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TMEM106B antibody
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TMEM106B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
transmembrane protein 106B
NCBI Official Synonym Full Names
transmembrane protein 106B
NCBI Official Symbol
Tmem106b
NCBI Official Synonym Symbols
AI428776; AI661344; 2310036D22Rik; 5830455K21Rik; 6430519M21Rik
NCBI Protein Information
transmembrane protein 106B
UniProt Protein Name
Transmembrane protein 106B
UniProt Gene Name
Tmem106b
UniProt Entry Name
T106B_MOUSE
Similar Products
Product Notes
The TMEM106B tmem106b (Catalog #AAA199802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tmem106b antibody - C-terminal region reacts with Tested Species Reactivity: Mouse Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tmem106b can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TMEM106B tmem106b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEEMSYMYDF CTLLSIKVHN IVLMMQVTVT TAYFGHSEQI SQERYQYVDC. It is sometimes possible for the material contained within the vial of "Tmem106b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
