Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281747_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using TMX2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit TMX2 Polyclonal Antibody | anti-TMX2 antibody

TMX2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TMX2; PIG26; CGI-31; PDIA12; TXNDC14
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TMX2, Antibody; TMX2 Rabbit pAb; TMX2; CGI-31; PDIA12; PIG26; TXNDC14; anti-TMX2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Applicable Applications for anti-TMX2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1).
Positive Samples
U-251MG, HeLa, HepG2, A-549, Mouse liver, Mouse brain, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using TMX2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281747_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using TMX2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human liver cancer using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281747_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human liver cancer using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat heart using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281747_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat heart using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse kidney using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281747_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse kidney using TMX2 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TMX2 pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281747_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TMX2 pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-TMX2 antibody
Background: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.3 kDa
NCBI Official Full Name
thioredoxin-related transmembrane protein 2 isoform 2
NCBI Official Synonym Full Names
thioredoxin related transmembrane protein 2
NCBI Official Symbol
TMX2
NCBI Official Synonym Symbols
PIG26; CGI-31; PDIA12; TXNDC14
NCBI Protein Information
thioredoxin-related transmembrane protein 2
UniProt Protein Name
Thioredoxin-related transmembrane protein 2
UniProt Gene Name
TMX2
UniProt Synonym Gene Names
TXNDC14
UniProt Entry Name
TMX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TMX2 tmx2 (Catalog #AAA281747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMX2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMX2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TMX2 tmx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KPPLYMGPEY IKYFNDKTID EELERDKRVT WIVEFFANWS NDCQSFAPIY ADLSLKYNCT GLNFGKVDVG RYTDVSTRYK VSTSPLTKQL PTLILFQGGK EAMRRPQIDK KGRAVSWTFS EENVIREFNL NELYQRAKKL SKAGDNIPEE QPVASTPTTV SDGENKKDK. It is sometimes possible for the material contained within the vial of "TMX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.