Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201654_WB15.jpg WB (Western Blot) (WB Suggested Anti-TNFRSF11B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit TNFRSF11B Polyclonal Antibody | anti-TNFRSF11B antibody

TNFRSF11B antibody - N-terminal region

Gene Names
TNFRSF11B; OPG; TR1; OCIF; PDB5
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TNFRSF11B, Antibody; TNFRSF11B antibody - N-terminal region; TNFSF13; TNFSF10; TNFSF11; VWF; VTN; THBS1; FN1; anti-TNFRSF11B antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV
Sequence Length
401
Applicable Applications for anti-TNFRSF11B antibody
WB (Western Blot)
Homology
Dog: 78%; Horse: 78%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 78%; Rat: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF11B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TNFRSF11B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA201654_WB15.jpg WB (Western Blot) (WB Suggested Anti-TNFRSF11B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TNFRSF11B antibody
This is a rabbit polyclonal antibody against TNFRSF11B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Product Categories/Family for anti-TNFRSF11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 11B
NCBI Official Synonym Full Names
TNF receptor superfamily member 11b
NCBI Official Symbol
TNFRSF11B
NCBI Official Synonym Symbols
OPG; TR1; OCIF; PDB5
NCBI Protein Information
tumor necrosis factor receptor superfamily member 11B
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 11B
UniProt Gene Name
TNFRSF11B
UniProt Synonym Gene Names
OCIF; OPG
UniProt Entry Name
TR11B_HUMAN

Similar Products

Product Notes

The TNFRSF11B tnfrsf11b (Catalog #AAA201654) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF11B antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF11B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TNFRSF11B tnfrsf11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDISIKWTTQ ETFPPKYLHY DEETSHQLLC DKCPPGTYLK QHCTAKWKTV. It is sometimes possible for the material contained within the vial of "TNFRSF11B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.