Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281572_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-937 cells using TNFRSF17 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit TNFRSF17 Polyclonal Antibody | anti-TNFRSF17 antibody

TNFRSF17 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TNFRSF17; BCM; BCMA; CD269; TNFRSF13A
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
TNFRSF17, Antibody; TNFRSF17 Rabbit pAb; TNFRSF17; BCM; BCMA; CD269; TNFRSF13A; anti-TNFRSF17 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Applicable Applications for anti-TNFRSF17 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFRSF17 (NP_001183.2).
Cellular Location
Cell membrane, Endomembrane system, Single-pass type III membrane protein
Positive Samples
SP2/0, Raji, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-937 cells using TNFRSF17 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281572_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-937 cells using TNFRSF17 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of SP2/0 cells using TNFRSF17 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281572_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of SP2/0 cells using TNFRSF17 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of Rat spleen, using TNFRSF17 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

product-image-AAA281572_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Rat spleen, using TNFRSF17 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TNFRSF17 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281572_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TNFRSF17 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-TNFRSF17 antibody
Background: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
608
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,843 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 17
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 17
NCBI Official Symbol
TNFRSF17
NCBI Official Synonym Symbols
BCM; BCMA; CD269; TNFRSF13A
NCBI Protein Information
tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 17
UniProt Gene Name
TNFRSF17
UniProt Synonym Gene Names
BCM; BCMA
UniProt Entry Name
TNR17_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TNFRSF17 tnfrsf17 (Catalog #AAA281572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF17 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF17 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the TNFRSF17 tnfrsf17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA. It is sometimes possible for the material contained within the vial of "TNFRSF17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.