Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201024_WB13.jpg WB (Western Blot) (WB Suggested Anti-TNS4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit TNS4 Polyclonal Antibody | anti-TNS4 antibody

TNS4 antibody - N-terminal region

Gene Names
TNS4; CTEN; PP14434
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNS4, Antibody; TNS4 antibody - N-terminal region; anti-TNS4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTGGSQAELAQSTMSMRKKEESEALDIKYIEVTSARSRCHDGPQHCSSPS
Sequence Length
715
Applicable Applications for anti-TNS4 antibody
WB (Western Blot)
Homology
Cow: 91%; Horse: 79%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TNS4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

product-image-AAA201024_WB13.jpg WB (Western Blot) (WB Suggested Anti-TNS4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

WB (Western Blot)

(Lanes:Lane 1: 30ug human 293T lysateLane 2: 30ug human BEL7402 cell lysateLane 3: 30ug human SMMC772 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:TNS4 aSubmitted by:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong)

product-image-AAA201024_WB15.jpg WB (Western Blot) (Lanes:Lane 1: 30ug human 293T lysateLane 2: 30ug human BEL7402 cell lysateLane 3: 30ug human SMMC772 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:TNS4 aSubmitted by:Dr Frankie Ko Chi Fat, Lo-Kong Chan, Irene O.L. Ng, Judy Wai Ping Yam; Department of Pathology, The University of Hong Kong)
Related Product Information for anti-TNS4 antibody
This is a rabbit polyclonal antibody against TNS4. It was validated on Western Blot

Target Description: TNS4 may be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton. It may promote apoptosis, via its cleavage by caspase-3.
Product Categories/Family for anti-TNS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
tensin-4
NCBI Official Synonym Full Names
tensin 4
NCBI Official Symbol
TNS4
NCBI Official Synonym Symbols
CTEN; PP14434
NCBI Protein Information
tensin-4
UniProt Protein Name
Tensin-4
UniProt Gene Name
TNS4
UniProt Synonym Gene Names
CTEN
UniProt Entry Name
TENS4_HUMAN

Similar Products

Product Notes

The TNS4 tns4 (Catalog #AAA201024) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNS4 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TNS4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TNS4 tns4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTGGSQAELA QSTMSMRKKE ESEALDIKYI EVTSARSRCH DGPQHCSSPS. It is sometimes possible for the material contained within the vial of "TNS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.