Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197607_WB11.jpg WB (Western Blot) (WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

Rabbit TP73 Polyclonal Antibody | anti-TP73 antibody

TP73 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TP73; P73
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TP73, Antibody; TP73 antibody - middle region; anti-TP73 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPA
Sequence Length
636
Applicable Applications for anti-TP73 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TP73
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

product-image-AAA197607_WB11.jpg WB (Western Blot) (WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA197607_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA197607_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-TP73 antibody
This is a rabbit polyclonal antibody against TP73. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
tumor protein p73 isoform a
NCBI Official Synonym Full Names
tumor protein p73
NCBI Official Symbol
TP73
NCBI Official Synonym Symbols
P73
NCBI Protein Information
tumor protein p73
UniProt Protein Name
Tumor protein p73
UniProt Gene Name
TP73
UniProt Synonym Gene Names
P73
UniProt Entry Name
P73_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TP73 tp73 (Catalog #AAA197607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP73 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TP73 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TP73 tp73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRSFEGRICA CPGRDRKADE DHYREQQALN ESSAKNGAAS KRAFKQSPPA. It is sometimes possible for the material contained within the vial of "TP73, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.