WB (Western Blot)
(WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: HepG2)
Rabbit TPM2 Polyclonal Antibody | anti-TPM2 antibody
TPM2 antibody - C-terminal region
Gene Names
TPM2; DA1; DA2B; NEM4; TMSB; AMCD1; HEL-S-273
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TPM2, Antibody; TPM2 antibody - C-terminal region; anti-TPM2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Sequence Length
284
Applicable Applications for anti-TPM2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 85%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TPM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: HepG2)
WB (Western Blot)
(WB Suggested Antibody Titration: 2.5 ug/mlPositive Control: HepG2)
IHC (Immunohistochemistry)
(Human Muscle)
IHC (Immunohistochemistry)
(Human Muscle)
Related Product Information for anti-TPM2 antibody
This is a rabbit polyclonal antibody against TPM2. It was validated on Western Blot and immunohistochemistry
Target Description: TPM2 is beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers (Tajsharghi et al., 2007 [PubMed 17846275]). See also TPM1 (MIM 191010), TPM3 (MIM 191030), and TPM4 (MIM 600317).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: TPM2 is beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers (Tajsharghi et al., 2007 [PubMed 17846275]). See also TPM1 (MIM 191010), TPM3 (MIM 191030), and TPM4 (MIM 600317).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TPM2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
tropomyosin beta chain isoform Tpm2.2st
NCBI Official Synonym Full Names
tropomyosin 2
NCBI Official Symbol
TPM2
NCBI Official Synonym Symbols
DA1; DA2B; NEM4; TMSB; AMCD1; HEL-S-273
NCBI Protein Information
tropomyosin beta chain
UniProt Protein Name
Tropomyosin beta chain
UniProt Gene Name
TPM2
UniProt Synonym Gene Names
TMSB
UniProt Entry Name
TPM2_HUMAN
Similar Products
Product Notes
The TPM2 tpm2 (Catalog #AAA199898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPM2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TPM2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TPM2 tpm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AETRAEFAER SVAKLEKTID DLEDEVYAQK MKYKAISEEL DNALNDITSL. It is sometimes possible for the material contained within the vial of "TPM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.