Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA225142_IHC11.jpg IHC (Immunohistochemisry) (Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

Rabbit anti-Human, Mouse Tropomyosin 2 Polyclonal Antibody | anti-TPM2 antibody

Tropomyosin 2 Antibody

Average rating 0.0
No ratings yet
Gene Names
Tm2; CG4843; DmelCG4843; dro Tm; DROTROPI1; Ifm(3)3; Ifm(3)5; Ifm-TmI; IP16005p; l(3)nc99Eb; mTmI; Tm; Tm1; Tm127; TM2; TmI; TmII; Tn-H
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Tropomyosin 2, Antibody; Tropomyosin 2 Antibody; Rabbit Polyclonal Tropomyosin 2 Antibody; Polyclonal Tropomyosin 2 antibody; Anti-Tropomyosin 2 antibody; Tropomyosin 2; Tropomyosin -2 antibody; Tropomyosin -2; TPM2 antibody; AMCD1 antibody; Tropomyosin 2 antibody; TMSB antibody; DA1 antibody; anti-TPM2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
284
Applicable Applications for anti-TPM2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Cross-Reactivity
Human,Mouse
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohistochemisry)

(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

product-image-AAA225142_IHC11.jpg IHC (Immunohistochemisry) (Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

WB (Western Blot)

(Tropomyosin 2 antibody used at 2.5 ug/ml to detect target protein.)

product-image-AAA225142_WB13.jpg WB (Western Blot) (Tropomyosin 2 antibody used at 2.5 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

product-image-AAA225142_IHC15.jpg IHC (Immunohistochemistry) (Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Related Product Information for anti-TPM2 antibody
The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.
Product Categories/Family for anti-TPM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
tropomyosin 2, isoform G
NCBI Official Synonym Full Names
Tropomyosin 2
NCBI Official Symbol
Tm2
NCBI Official Synonym Symbols
CG4843; DmelCG4843; dro Tm; DROTROPI1; Ifm(3)3; Ifm(3)5; Ifm-TmI; IP16005p; l(3)nc99Eb; mTmI; Tm; Tm1; Tm127; TM2; TmI; TmII; Tn-H
NCBI Protein Information
tropomyosin 2
UniProt Protein Name
Tropomyosin-2
UniProt Gene Name
Tm2
UniProt Synonym Gene Names
TmI

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TPM2 tm2 (Catalog #AAA225142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tropomyosin 2 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Tropomyosin 2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TPM2 tm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tropomyosin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.