Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201529_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TRAF3Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TRAF3 Polyclonal Antibody | anti-TRAF3 antibody

TRAF3 Antibody - C-terminal region

Gene Names
TRAF3; CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TRAF3, Antibody; TRAF3 Antibody - C-terminal region; anti-TRAF3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASG
Sequence Length
485
Applicable Applications for anti-TRAF3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: TRAF3Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201529_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TRAF3Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: TRAF3Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA201529_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: TRAF3Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-TRAF3 antibody
This is a rabbit polyclonal antibody against TRAF3. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.
Product Categories/Family for anti-TRAF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
TNF receptor-associated factor 3
NCBI Official Synonym Full Names
TNF receptor associated factor 3
NCBI Official Symbol
TRAF3
NCBI Official Synonym Symbols
CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
NCBI Protein Information
TNF receptor-associated factor 3
UniProt Protein Name
TNF receptor-associated factor 3
UniProt Gene Name
TRAF3
UniProt Synonym Gene Names
CAP1; CRAF1; CRAF1; CD40BP; LAP1
UniProt Entry Name
TRAF3_HUMAN

Similar Products

Product Notes

The TRAF3 traf3 (Catalog #AAA201529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAF3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TRAF3 traf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALLPWPFKQK VTLMLMDQGS SRRHLGDAFK PDPNSSSFKK PTGEMNIASG. It is sometimes possible for the material contained within the vial of "TRAF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.