Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282363_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded human breast cancer using TRAF6BP/TRAF6BP/TAX1BP1 antibody (AAA282363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit anti-Human, Rat TRAF6BP/TAX1BP1 Polyclonal Antibody | anti-TRAF6BP/TAX1BP1 antibody

TRAF6BP/TAX1BP1 Rabbit pAb

Gene Names
TAX1BP1; T6BP; TXBP151; CALCOCO3
Reactivity
Human, Rat
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
TRAF6BP/TAX1BP1, Antibody; TRAF6BP/TAX1BP1 Rabbit pAb; T6BP; TXBP151; CALCOCO3; anti-TRAF6BP/TAX1BP1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
QHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Applicable Applications for anti-TRAF6BP/TAX1BP1 antibody
IHC (Immunohistochemistry)
Cellular Location
cytosol, extracellular exosome
Research Area
Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, NF-kB Signaling Pathway
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 709-789 of human TRAF6BP/TRAF6BP/TAX1BP1 (NP_006015.4).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded human breast cancer using TRAF6BP/TRAF6BP/TAX1BP1 antibody (AAA282363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282363_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded human breast cancer using TRAF6BP/TRAF6BP/TAX1BP1 antibody (AAA282363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded human lung cancer using TRAF6BP/TRAF6BP/TAX1BP1 antibody (AAA282363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282363_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded human lung cancer using TRAF6BP/TRAF6BP/TAX1BP1 antibody (AAA282363) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-TRAF6BP/TAX1BP1 antibody
This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TRAF6BP/TAX1BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90,877 Da
NCBI Official Full Name
tax1-binding protein 1 isoform 3
NCBI Official Synonym Full Names
Tax1 (human T-cell leukemia virus type I) binding protein 1
NCBI Official Symbol
TAX1BP1
NCBI Official Synonym Symbols
T6BP; TXBP151; CALCOCO3
NCBI Protein Information
tax1-binding protein 1; TRAF6-binding protein
UniProt Protein Name
Tax1-binding protein 1
UniProt Gene Name
TAX1BP1
UniProt Synonym Gene Names
T6BP
UniProt Entry Name
TAXB1_HUMAN

Similar Products

Product Notes

The TRAF6BP/TAX1BP1 tax1bp1 (Catalog #AAA282363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAF6BP/TAX1BP1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF6BP/TAX1BP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRAF6BP/TAX1BP1 tax1bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QHLRGHGTGF CFDSSFDVHK KCPLCELMFP PNYDQSKFEE HVESHWKVCP MCSEQFPPDY DQQVFERHVQ THFDQNVLNF D. It is sometimes possible for the material contained within the vial of "TRAF6BP/TAX1BP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.