WB (Western Blot)
(WB Suggested Anti-TRIM28 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateTRIM28 is supported by BioGPS gene expression data to be expressed in HeLa)
Rabbit TRIM28 Polyclonal Antibody | anti-TRIM28 antibody
TRIM28 antibody - N-terminal region
Gene Names
TRIM28; KAP1; TF1B; RNF96; TIF1B; PPP1R157
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TRIM28, Antibody; TRIM28 antibody - N-terminal region; anti-TRIM28 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGD
Sequence Length
835
Applicable Applications for anti-TRIM28 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM28
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TRIM28 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateTRIM28 is supported by BioGPS gene expression data to be expressed in HeLa)
WB (Western Blot)
(WB Suggested Anti-TRIM28 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateTRIM28 is supported by BioGPS gene expression data to be expressed in HeLa)
IHC (Immunohistochemistry)
(Rabbit Anti-TRIM28 antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-TRIM28 antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TRIM28 antibody
This is a rabbit polyclonal antibody against TRIM28. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRIM28 mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. TRIM28 localizes to the nucleus and is thought to associate with specific chromatin regions. It is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING,a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: TRIM28 mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. TRIM28 localizes to the nucleus and is thought to associate with specific chromatin regions. It is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING,a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TRIM28 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Synonym Full Names
tripartite motif containing 28
NCBI Official Symbol
TRIM28
NCBI Official Synonym Symbols
KAP1; TF1B; RNF96; TIF1B; PPP1R157
NCBI Protein Information
transcription intermediary factor 1-beta
UniProt Protein Name
Transcription intermediary factor 1-beta
UniProt Gene Name
TRIM28
UniProt Synonym Gene Names
KAP1; RNF96; TIF1B; TIF1-beta; KAP-1; KRIP-1
UniProt Entry Name
TIF1B_HUMAN
Similar Products
Product Notes
The TRIM28 trim28 (Catalog #AAA197429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM28 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM28 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRIM28 trim28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLVLFCESCD TLTCRDCQLN AHKDHQYQFL EDAVRNQRKL LASLVKRLGD. It is sometimes possible for the material contained within the vial of "TRIM28, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.