Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281569_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using TRIM31 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse TRIM31 Polyclonal Antibody | anti-TRIM31 antibody

TRIM31 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TRIM31; RNF; HCG1; HCGI; C6orf13
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
TRIM31, Antibody; TRIM31 Rabbit pAb; TRIM31; C6orf13; HCG1; HCGI; RNF; anti-TRIM31 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Applicable Applications for anti-TRIM31 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 186-425 of human TRIM31 (NP_008959.3).
Cellular Location
Cytoplasm, Mitochondrion
Positive Samples
HT-29, Mouse large intestine, Mouse small intestine
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using TRIM31 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281569_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using TRIM31 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TRIM31 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA281569_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TRIM31 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-TRIM31 antibody
Background: This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,244 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM31
NCBI Official Synonym Full Names
tripartite motif containing 31
NCBI Official Symbol
TRIM31
NCBI Official Synonym Symbols
RNF; HCG1; HCGI; C6orf13
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM31; ring finger protein; tripartite motif-containing 31 gamma; tripartite motif-containing protein 31
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM31
UniProt Gene Name
TRIM31
UniProt Synonym Gene Names
C6orf13; RNF
UniProt Entry Name
TRI31_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRIM31 trim31 (Catalog #AAA281569) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM31 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM31 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the TRIM31 trim31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELLHQVLEEE KNFLLSRIYW LGHEGTEAGK HYVASTEPQL NDLKKLVDSL KTKQNMPPRQ LLEDIKVVLC RSEEFQFLNP TPVPLELEKK LSEAKSRHDS ITGSLKKFKD QLQADRKKDE NRFFKSMNKN DMKSWGLLQK NNHKMNKTSE PGSSSAGGRT TSGPPNHHSS APSHSLFRAS SAGKVTFPVC LLASYDEISG QGASSQDTKT FDVALSEELH AALSEWLTAI RAWFCEVPSS. It is sometimes possible for the material contained within the vial of "TRIM31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.