Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199435_WB10.jpg WB (Western Blot) (TRPM2 antibody - N-terminal region validated by WB using Fetal Brain Lysate at 1ug/ml.)

Rabbit TRPM2 Polyclonal Antibody | anti-TRPM2 antibody

TRPM2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TRPM2; KNP3; EREG1; TRPC7; LTRPC2; NUDT9H; LTrpC-2; NUDT9L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TRPM2, Antibody; TRPM2 antibody - N-terminal region; anti-TRPM2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
Sequence Length
1503
Applicable Applications for anti-TRPM2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 88%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(TRPM2 antibody - N-terminal region validated by WB using Fetal Brain Lysate at 1ug/ml.)

product-image-AAA199435_WB10.jpg WB (Western Blot) (TRPM2 antibody - N-terminal region validated by WB using Fetal Brain Lysate at 1ug/ml.)

WB (Western Blot)

(Host: RabbitTarget Name: TRPM2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199435_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TRPM2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Sample Type: human heartAnti-TRPM2 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA199435_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: human heartAnti-TRPM2 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: human brain, cortexAnti-TRPM2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA199435_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: human brain, cortexAnti-TRPM2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)
Related Product Information for anti-TRPM2 antibody
This is a rabbit polyclonal antibody against TRPM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death.The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
171kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily M member 2 isoform 1
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily M member 2
NCBI Official Symbol
TRPM2
NCBI Official Synonym Symbols
KNP3; EREG1; TRPC7; LTRPC2; NUDT9H; LTrpC-2; NUDT9L1
NCBI Protein Information
transient receptor potential cation channel subfamily M member 2
UniProt Protein Name
Transient receptor potential cation channel subfamily M member 2
UniProt Gene Name
TRPM2
UniProt Synonym Gene Names
EREG1; KNP3; LTRPC2; TRPC7; LTrpC-2; LTrpC2; TrpC7
UniProt Entry Name
TRPM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRPM2 trpm2 (Catalog #AAA199435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPM2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPM2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRPM2 trpm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAILQALLKA SRSQDHFGHE NWDHQLKLAV AWNRVDIARS EIFMDEWQWK. It is sometimes possible for the material contained within the vial of "TRPM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.