Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197956_WB11.jpg WB (Western Blot) (Trpv6 antibody - middle region validated by WB using Rat Brain lysate at 1ug/ml.)

Rabbit Trpv6 Polyclonal Antibody | anti-TRPV6 antibody

Trpv6 antibody - middle region

Gene Names
Trpv6; CaT1; Ecac2; Otrpc3
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Trpv6, Antibody; Trpv6 antibody - middle region; anti-TRPV6 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC
Sequence Length
727
Applicable Applications for anti-TRPV6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Trpv6 antibody - middle region validated by WB using Rat Brain lysate at 1ug/ml.)

product-image-AAA197956_WB11.jpg WB (Western Blot) (Trpv6 antibody - middle region validated by WB using Rat Brain lysate at 1ug/ml.)

WB (Western Blot)

(Sample Type: HumanSample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-rabbit-APSecondary Dilution: 1:2000Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)

product-image-AAA197956_WB13.jpg WB (Western Blot) (Sample Type: HumanSample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-rabbit-APSecondary Dilution: 1:2000Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)

IHC (Immunohistochemistry)

(Sample Type: HumanSample Type: hRetinal pigment epithelial cellsGreen: primaryRed: nuclearPrimary Dilution: 1:200Secondary Antibody: goat anti-rabbit-Alexa 488Secondary Dilution: 1:500Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)

product-image-AAA197956_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: HumanSample Type: hRetinal pigment epithelial cellsGreen: primaryRed: nuclearPrimary Dilution: 1:200Secondary Antibody: goat anti-rabbit-Alexa 488Secondary Dilution: 1:500Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)
Related Product Information for anti-TRPV6 antibody
This is a rabbit polyclonal antibody against Trpv6. It was validated on Western Blot

Target Description: Trpv6 is a Ca(2+)-sensing Ca(2+) channel.
Product Categories/Family for anti-TRPV6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 6
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily V, member 6
NCBI Official Symbol
Trpv6
NCBI Official Synonym Symbols
CaT1; Ecac2; Otrpc3
NCBI Protein Information
transient receptor potential cation channel subfamily V member 6
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 6
UniProt Gene Name
Trpv6
UniProt Synonym Gene Names
TrpV6; CaT1; ECaC2
UniProt Entry Name
TRPV6_RAT

Similar Products

Product Notes

The TRPV6 trpv6 (Catalog #AAA197956) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Trpv6 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Trpv6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TRPV6 trpv6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEIDSSGDDQ SLLELIVTTK KREARQILDQ TPVKELVSLK WKRYGRPYFC. It is sometimes possible for the material contained within the vial of "Trpv6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.