Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201036_WB15.jpg WB (Western Blot) (WB Suggested Anti-TSLP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit TSLP Polyclonal Antibody | anti-TSLP antibody

TSLP antibody - C-terminal region

Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Dog, Horse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSLP, Antibody; TSLP antibody - C-terminal region; anti-TSLP antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Dog, Horse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% (w/v) sodium azide.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL
Sequence Length
159
Applicable Applications for anti-TSLP antibody
WB (Western Blot)
Homology
Dog: 79%; Horse: 86%; Human: 100%
Protein Size (# AA)
159 amino acids
Protein Interactions
APP; PRNP; IKBKG; STAT5A; CRLF2; IL7R; STAT3;
Blocking Peptide
Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TSLP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

product-image-AAA201036_WB15.jpg WB (Western Blot) (WB Suggested Anti-TSLP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-TSLP antibody
This is a rabbit polyclonal antibody against TSLP. It was validated on Western Blot

Target Description: This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants.
Product Categories/Family for anti-TSLP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
thymic stromal lymphopoietin isoform 1
NCBI Official Synonym Full Names
thymic stromal lymphopoietin
NCBI Official Symbol
TSLP
NCBI Protein Information
thymic stromal lymphopoietin
UniProt Protein Name
Thymic stromal lymphopoietin
UniProt Gene Name
TSLP
UniProt Entry Name
TSLP_HUMAN

Similar Products

Product Notes

The TSLP tslp (Catalog #AAA201036) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSLP antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Dog, Horse and may cross-react with other species as described in the data sheet. AAA Biotech's TSLP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TSLP tslp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCASLAKEMF AMKTKAALAI WCPGYSETQI NATQAMKKRR KRKVTTNKCL. It is sometimes possible for the material contained within the vial of "TSLP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.