WB (Western Blot)
(WB Suggested Anti-TUBA4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Rabbit TUBA4A Polyclonal Antibody | anti-TUBA4A antibody
TUBA4A antibody - middle region
Gene Names
TUBA4A; ALS22; TUBA1; H2-ALPHA
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TUBA4A, Antibody; TUBA4A antibody - middle region; anti-TUBA4A antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
Sequence Length
448
Applicable Applications for anti-TUBA4A antibody
WB (Western Blot)
Homology
Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TUBA4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TUBA4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
WB (Western Blot)
(WB Suggested Anti-TUBA4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
WB (Western Blot)
(Host: RatTarget Name: TUBA1ASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RatTarget Name: TUBA1ASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
Related Product Information for anti-TUBA4A antibody
This is a rabbit polyclonal antibody against TUBA4A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of si
Target Description: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of si
Product Categories/Family for anti-TUBA4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
tubulin alpha-4A chain isoform 1
NCBI Official Synonym Full Names
tubulin alpha 4a
NCBI Official Symbol
TUBA4A
NCBI Official Synonym Symbols
ALS22; TUBA1; H2-ALPHA
NCBI Protein Information
tubulin alpha-4A chain
UniProt Protein Name
Tubulin alpha-4A chain
UniProt Gene Name
TUBA4A
UniProt Synonym Gene Names
TUBA1
UniProt Entry Name
TBA4A_HUMAN
Similar Products
Product Notes
The TUBA4A tuba4a (Catalog #AAA198573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBA4A antibody - middle region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TUBA4A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TUBA4A tuba4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGTGSGFTSL LMERLSVDYG KKSKLEFSIY PAPQVSTAVV EPYNSILTTH. It is sometimes possible for the material contained within the vial of "TUBA4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.