Rabbit anti-Human TYROBP Polyclonal Antibody | anti-TYROBP antibody
TYROBP Antibody - middle region
Gene Names
TYROBP; DAP12; KARAP; PLOSL; PLOSL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TYROBP, Antibody; TYROBP Antibody - middle region; anti-TYROBP antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: IALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLN
Sequence Length
144
Applicable Applications for anti-TYROBP antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TYROBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TYROBP antibody
This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-TYROBP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15 kDa
NCBI Official Full Name
TYRO protein tyrosine kinase-binding protein isoform 3
NCBI Official Synonym Full Names
TYRO protein tyrosine kinase binding protein
NCBI Official Symbol
TYROBP
NCBI Official Synonym Symbols
DAP12; KARAP; PLOSL; PLOSL1
NCBI Protein Information
TYRO protein tyrosine kinase-binding protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TYROBP (Catalog #AAA201584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYROBP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TYROBP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TYROBP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IALAVYFLGR LVPRGRGAAE AATRKQRITE TESPYQELQG QRSDVYSDLN. It is sometimes possible for the material contained within the vial of "TYROBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
