Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200091_WB11.jpg WB (Western Blot) (WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Pancreas)

Rabbit UBA3 Polyclonal Antibody | anti-UBA3 antibody

UBA3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
UBA3; NAE2; UBE1C; hUBA3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
UBA3, Antibody; UBA3 antibody - N-terminal region; anti-UBA3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL
Sequence Length
463
Applicable Applications for anti-UBA3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UBA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Pancreas)

product-image-AAA200091_WB11.jpg WB (Western Blot) (WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Pancreas)

WB (Western Blot)

(Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

product-image-AAA200091_WB13.jpg WB (Western Blot) (Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :UBA3: Red DAPI:BlueGene Name :UBA3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA200091_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :UBA3: Red DAPI:BlueGene Name :UBA3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-UBA3 antibody
This is a rabbit polyclonal antibody against UBA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBA3 is a catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. UBA3 down-regulates steroid receptor activity. UBA3 is necessary for cell cycle progression.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
NEDD8-activating enzyme E1 catalytic subunit isoform 1
NCBI Official Synonym Full Names
ubiquitin like modifier activating enzyme 3
NCBI Official Symbol
UBA3
NCBI Official Synonym Symbols
NAE2; UBE1C; hUBA3
NCBI Protein Information
NEDD8-activating enzyme E1 catalytic subunit
UniProt Protein Name
NEDD8-activating enzyme E1 catalytic subunit
UniProt Gene Name
UBA3
UniProt Synonym Gene Names
UBE1C; Ubiquitin-activating enzyme 3
UniProt Entry Name
UBA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBA3 uba3 (Catalog #AAA200091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBA3 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the UBA3 uba3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGRWNHVKKF LERSGPFTHP DFEPSTESLQ FLLDTCKVLV IGAGGLGCEL. It is sometimes possible for the material contained within the vial of "UBA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.