Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate.UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit UBE2D3 Polyclonal Antibody | anti-UBE2D3 antibody

UBE2D3 antibody - N-terminal region

Gene Names
UBE2D3; UBC4/5; UBCH5C; E2(17)KB3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE2D3, Antibody; UBE2D3 antibody - N-terminal region; anti-UBE2D3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF
Sequence Length
147
Applicable Applications for anti-UBE2D3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Yeast: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate.UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate.UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2D3Submitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)

WB (Western Blot) (Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2D3Submitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)

WB (Western Blot)

(Host: RabbitTarget Name: UBE2D3Sample Type: MCF7Antibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (Host: RabbitTarget Name: UBE2D3Sample Type: MCF7Antibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: UBE2D3Sample Type: JurkatAntibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (Host: RabbitTarget Name: UBE2D3Sample Type: JurkatAntibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: UBE2D3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: UBE2D3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UBE2D3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: UBE2D3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UBE2D3Sample Type: 293TAntibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

WB (Western Blot) (Host: RabbitTarget Name: UBE2D3Sample Type: 293TAntibody Dilution: 1.0ug/mlUBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-UBE2D3 antibody
This is a rabbit polyclonal antibody against UBE2D3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Product Categories/Family for anti-UBE2D3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 D3 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 D3
NCBI Official Symbol
UBE2D3
NCBI Official Synonym Symbols
UBC4/5; UBCH5C; E2(17)KB3
NCBI Protein Information
ubiquitin-conjugating enzyme E2 D3
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 D3
UniProt Gene Name
UBE2D3
UniProt Synonym Gene Names
UBC5C; UBCH5C
UniProt Entry Name
UB2D3_HUMAN

Similar Products

Product Notes

The UBE2D3 ube2d3 (Catalog #AAA23507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2D3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2D3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2D3 ube2d3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MALKRINKEL SDLARDPPAQ CSAGPVGDDM FHWQATIMGP NDSPYQGGVF. It is sometimes possible for the material contained within the vial of "UBE2D3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.