Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199202_WB10.jpg WB (Western Blot) (WB Suggested Anti-UBE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateUBE3A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit UBE3A Polyclonal Antibody | anti-UBE3A antibody

UBE3A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
UBE3A; AS; ANCR; E6-AP; HPVE6A; EPVE6AP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE3A, Antibody; UBE3A antibody - middle region; anti-UBE3A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Sequence Length
875
Applicable Applications for anti-UBE3A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateUBE3A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA199202_WB10.jpg WB (Western Blot) (WB Suggested Anti-UBE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateUBE3A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Lanes:Lane 1: 7ug HeLa lysate+EGFP SiRNALane 2: 7ug HeLa lysate+UBE3A SiRNAPrimary Antibody Dilution:1:300Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:UBE3ASubmitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)

product-image-AAA199202_WB11.jpg WB (Western Blot) (Lanes:Lane 1: 7ug HeLa lysate+EGFP SiRNALane 2: 7ug HeLa lysate+UBE3A SiRNAPrimary Antibody Dilution:1:300Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:UBE3ASubmitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)

WB (Western Blot)

(Host: RabbitTarget Name: UBE3ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA199202_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: UBE3ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: UBE3ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA199202_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: UBE3ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBE3A antibody
This is a rabbit polyclonal antibody against UBE3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBE3A is an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53. Alternative splicing of this gene results in three transcript variants encoding three isoforms with different N-termini. Additional transcript variants have been described, but their full length nature has not been determined.
Product Categories/Family for anti-UBE3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
ubiquitin-protein ligase E3A isoform 2
NCBI Official Synonym Full Names
ubiquitin protein ligase E3A
NCBI Official Symbol
UBE3A
NCBI Official Synonym Symbols
AS; ANCR; E6-AP; HPVE6A; EPVE6AP
NCBI Protein Information
ubiquitin-protein ligase E3A
UniProt Protein Name
Ubiquitin-protein ligase E3A
UniProt Gene Name
UBE3A
UniProt Synonym Gene Names
E6AP; EPVE6AP; HPVE6A
UniProt Entry Name
UBE3A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE3A ube3a (Catalog #AAA199202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE3A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE3A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UBE3A ube3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKNGPDTERL PTSHTCFNVL LLPEYSSKEK LKERLLKAIT YAKGFGML. It is sometimes possible for the material contained within the vial of "UBE3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.