Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201170_WB11.jpg WB (Western Blot) (WB Suggested Anti-UCP1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellUCP1 is supported by BioGPS gene expression data to be expressed in A549)

Rabbit UCP1 Polyclonal Antibody | anti-UCP1 antibody

UCP1 antibody - C-terminal region

Gene Names
UCP1; UCP; SLC25A7
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UCP1, Antibody; UCP1 antibody - C-terminal region; anti-UCP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMD
Sequence Length
307
Applicable Applications for anti-UCP1 antibody
WB (Western Blot)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 91%; Sheep: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UCP1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellUCP1 is supported by BioGPS gene expression data to be expressed in A549)

product-image-AAA201170_WB11.jpg WB (Western Blot) (WB Suggested Anti-UCP1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellUCP1 is supported by BioGPS gene expression data to be expressed in A549)

WB (Western Blot)

(Host: RabbitTarget Name: UCP1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201170_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: UCP1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UCP1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201170_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: UCP1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-UCP1 antibody
This is a rabbit polyclonal antibody against UCP1. It was validated on Western Blot

Target Description: Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat.
Product Categories/Family for anti-UCP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
mitochondrial brown fat uncoupling protein 1
NCBI Official Synonym Full Names
uncoupling protein 1
NCBI Official Symbol
UCP1
NCBI Official Synonym Symbols
UCP; SLC25A7
NCBI Protein Information
mitochondrial brown fat uncoupling protein 1
UniProt Protein Name
Mitochondrial brown fat uncoupling protein 1
UniProt Gene Name
UCP1
UniProt Synonym Gene Names
SLC25A7; UCP; UCP 1
UniProt Entry Name
UCP1_HUMAN

Similar Products

Product Notes

The UCP1 ucp1 (Catalog #AAA201170) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCP1 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's UCP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UCP1 ucp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMKVFTNEGP TAFFKGLVPS FLRLGSWNVI MFVCFEQLKR ELSKSRQTMD. It is sometimes possible for the material contained within the vial of "UCP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.