Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using UHRF2 antibody at dilution of 1:200 (40x lens).)

Rabbit UHRF2 Polyclonal Antibody | anti-UHRF2 antibody

UHRF2 Polyclonal Antibody

Gene Names
UHRF2; NIRF; URF2; RNF107; TDRD23
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
UHRF2, Antibody; UHRF2 Polyclonal Antibody; NIRF; RNF107; TDRD23; URF2; anti-UHRF2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
IVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTS
Sequence Length
802
Applicable Applications for anti-UHRF2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human UHRF2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse lung using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human kidney cancer using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human kidney cancer using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human oophoroma using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human oophoroma using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat Intestine using UHRF2 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat Intestine using UHRF2 antibody at dilution of 1:200 (40x lens).)
Related Product Information for anti-UHRF2 antibody
This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Product Categories/Family for anti-UHRF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa/89kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase UHRF2
NCBI Official Synonym Full Names
ubiquitin like with PHD and ring finger domains 2
NCBI Official Symbol
UHRF2
NCBI Official Synonym Symbols
NIRF; URF2; RNF107; TDRD23
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF2
UniProt Protein Name
E3 ubiquitin-protein ligase UHRF2
UniProt Gene Name
UHRF2
UniProt Synonym Gene Names
NIRF; RNF107; Np95-like RING finger protein

Similar Products

Product Notes

The UHRF2 uhrf2 (Catalog #AAA28267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UHRF2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UHRF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the UHRF2 uhrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IVPSNHYGPI PGIPVGSTWR FRVQVSEAGV HRPHVGGIHG RSNDGAYSLV LAGGFADEVD RGDEFTYTGS GGKNLAGNKR IGAPSADQTL TNMNRALALN CDAPLDDKIG AESRNWRAGK PVRVIRSFKG RKISKYAPEE GNRYDGIYKV VKYWPEISSS HGFLVWRYLL RRDDVEPAPW TS. It is sometimes possible for the material contained within the vial of "UHRF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.