Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198068_WB13.jpg WB (Western Blot) (WB Suggested Anti-UPF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit UPF1 Polyclonal Antibody | anti-UPF1 antibody

UPF1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
UPF1; HUPF1; NORF1; RENT1; smg-2; pNORF1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
UPF1, Antibody; UPF1 antibody - middle region; anti-UPF1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
Sequence Length
1118
Applicable Applications for anti-UPF1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UPF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UPF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

product-image-AAA198068_WB13.jpg WB (Western Blot) (WB Suggested Anti-UPF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

IHC (Immunohistochemistry)

(Rabbit Anti-UPF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198068_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-UPF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-UPF1 antibody
This is a rabbit polyclonal antibody against UPF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. UPF1 is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene.This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
regulator of nonsense transcripts 1 isoform 2
NCBI Official Synonym Full Names
UPF1 RNA helicase and ATPase
NCBI Official Symbol
UPF1
NCBI Official Synonym Symbols
HUPF1; NORF1; RENT1; smg-2; pNORF1
NCBI Protein Information
regulator of nonsense transcripts 1
UniProt Protein Name
Regulator of nonsense transcripts 1
UniProt Gene Name
UPF1
UniProt Synonym Gene Names
KIAA0221; RENT1; NORF1; hUpf1
UniProt Entry Name
RENT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UPF1 upf1 (Catalog #AAA198068) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UPF1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UPF1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the UPF1 upf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGTPKGKTGR GGRQKNRFGL PGPSQTNLPN SQASQDVASQ PFSQGALTQG. It is sometimes possible for the material contained within the vial of "UPF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.