Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200804_WB10.jpg WB (Western Blot) (WB Suggested Anti-USP22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Rabbit USP22 Polyclonal Antibody | anti-USP22 antibody

USP22 antibody - middle region

Gene Names
USP22; USP3L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USP22, Antibody; USP22 antibody - middle region; anti-USP22 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
Sequence Length
525
Applicable Applications for anti-USP22 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human USP22
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-USP22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

product-image-AAA200804_WB10.jpg WB (Western Blot) (WB Suggested Anti-USP22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200804_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: USP22Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA200804_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: USP22Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200804_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: USP22Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-USP22 antibody
This is a rabbit polyclonal antibody against USP22. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 22
NCBI Official Synonym Full Names
ubiquitin specific peptidase 22
NCBI Official Symbol
USP22
NCBI Official Synonym Symbols
USP3L
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 22
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 22
UniProt Gene Name
USP22
UniProt Synonym Gene Names
KIAA1063; USP3L
UniProt Entry Name
UBP22_HUMAN

Similar Products

Product Notes

The USP22 usp22 (Catalog #AAA200804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP22 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's USP22 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the USP22 usp22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSSCLVCEMS SLFQEFYSGH RSPHIPYKLL HLVWTHARHL AGYEQQDAHE. It is sometimes possible for the material contained within the vial of "USP22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.