IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using USP4 Rabbit pAb (AAA282392) at dilution of 1:100. Blue: DAPI for nuclear staining.)
Rabbit anti-Human, Mouse USP4 Polyclonal Antibody | anti-USP4 antibody
USP4 Rabbit pAb
Gene Names
USP4; UNP; Unph
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
USP4, Antibody; USP4 Rabbit pAb; UNP; Unph; anti-USP4 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ
Applicable Applications for anti-USP4 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cellular Location
Cytoplasm, Nucleus
Research Area
Epigenetics Nuclear Signaling, Cell Biology Developmental Biology, Ubiquitin
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human USP4 (NP_003354.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack
Ship: Ice Pack
IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using USP4 Rabbit pAb (AAA282392) at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using USP4 Rabbit pAb (AAA282392) at dilution of 1:100. Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using USP4 antibody (AAA282392) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using USP4 antibody (AAA282392) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.)
Related Product Information for anti-USP4 antibody
The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-USP4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,661 Da
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 4 isoform c
NCBI Official Synonym Full Names
ubiquitin specific peptidase 4 (proto-oncogene)
NCBI Official Symbol
USP4
NCBI Official Synonym Symbols
UNP; Unph
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 4; deubiquitinating enzyme 4; ubiquitin carboxyl-terminal esterase 4; ubiquitin specific protease 4 (proto-oncogene); ubiquitin thioesterase 4; ubiquitin thiolesterase 4; ubiquitin-specific processing protease 4; ubiq
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 4
UniProt Gene Name
USP4
UniProt Synonym Gene Names
UNP; UNPH
UniProt Entry Name
UBP4_HUMAN
Similar Products
Product Notes
The USP4 usp4 (Catalog #AAA282392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP4 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's USP4 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the USP4 usp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DDIFVYEVCS TSVDGSECVT LPVYFRERKS RPSSTSSASA LYGQPLLLSV PKHKLTLESL YQAVCDRISR YVKQPLPDEF GSSPLEPGAC NGSRNSCEGE DEEEMEHQEE GKEQLSETEG SGEDEPGNDP SETTQKKIKG Q. It is sometimes possible for the material contained within the vial of "USP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.