Villin Polyclonal Antibody | anti-VIL1 antibody

Anti-Villin Antibody

Cat. Num. AAA46536

• Gene Names: VIL1; VIL; D2S1471
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: Villin, Antibody; Anti-Villin Antibody; Villin-1; D2S1471; OTTHUMP00000164145; VIL; VIL1; VILI_HUMAN; Villin 1; Villin1; villin 1; anti-VIL1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 827

• Applicable Applications for anti-VIL1 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Villin Picoband antibody, AAA46536,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- Villin Picoband antibody, AAA46536,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- Villin Picoband antibody, AAA46536,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- Villin Picoband antibody, AAA46536, Western blottingAll lanes: Anti Villin (AAA46536) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: RH35 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 93KD)

Related Product Information for anti-VIL1 antibody

Description: Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

References

1. Friederich, E; Vancompernolle, K; Louvard, D; Vandekerckhove, J (1999). "Villin function in the organization of the actin cytoskeleton. Correlation of in vivo effects to its biochemical activities in vitro". The Journal of Biological Chemistry274 (38): 26751-60. 2. Meng, J; Vardar, D; Wang, Y; Guo, HC; Head, JF; McKnight, CJ (2005). "High-resolution crystal structures of villin headpiece and mutants with reduced F-actin binding activity". Biochemistry 44 (36): 11963-73.

NCBI and Uniprot Product Information

• NCBI GI #: 194394237
• NCBI GeneID: 7429
• NCBI Accession #: NP_009058.2
• NCBI GenBank Nucleotide #: NM_007127.2
• UniProt Accession #: P09327; Q53S11; Q96AC8; B2R9A7
• Molecular Weight: 46,567 Da
• NCBI Official Full Name: villin-1
• NCBI Official Synonym Full Names: villin 1
• NCBI Official Symbol: VIL1
• NCBI Official Synonym Symbols: VIL; D2S1471
• NCBI Protein Information: villin-1
• UniProt Protein Name: Villin-1
• UniProt Gene Name: VIL1
• UniProt Synonym Gene Names: VIL
• UniProt Entry Name: VILI_HUMAN