Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281727_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using WIPF1 antibody at dilution of 1:100 (40x lens).)

Rabbit WIPF1 Polyclonal Antibody | anti-WIPF1 antibody

WIPF1 Rabbit pAb

Gene Names
WIPF1; WIP; PRPL-2; WASPIP
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
WIPF1, Antibody; WIPF1 Rabbit pAb; WIPF1; PRPL-2; WAS2; WASPIP; WIP; anti-WIPF1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP
Applicable Applications for anti-WIPF1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1).
Positive Samples
RAW264.7, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using WIPF1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281727_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using WIPF1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human esophageal using WIPF1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281727_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human esophageal using WIPF1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human appendix using WIPF1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281727_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human appendix using WIPF1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using WIPF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281727_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using WIPF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-WIPF1 antibody
Background: This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-WIPF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,258 Da
NCBI Official Full Name
WAS/WASL-interacting protein family member 1
NCBI Official Synonym Full Names
WAS/WASL interacting protein family, member 1
NCBI Official Symbol
WIPF1
NCBI Official Synonym Symbols
WIP; PRPL-2; WASPIP
NCBI Protein Information
WAS/WASL-interacting protein family member 1; protein PRPL-2; WASP-interacting protein; Wiskott-Aldrich syndrome protein interacting protein
UniProt Protein Name
WAS/WASL-interacting protein family member 1
UniProt Gene Name
WIPF1
UniProt Synonym Gene Names
WASPIP; WIP; WASP-interacting protein
UniProt Entry Name
WIPF1_HUMAN

Similar Products

Product Notes

The WIPF1 wipf1 (Catalog #AAA281727) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WIPF1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WIPF1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the WIPF1 wipf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QLPSRSGVDS PRSGPRPPLP PDRPSAGAPP PPPPSTSIRN GFQDSPCEDE WESRFYFHPI SDLPPPEPYV QTTKSYPSKL ARNESRSGSN RRERGAPPLP P. It is sometimes possible for the material contained within the vial of "WIPF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.